PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_29863-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 163aa    MW: 18589.9 Da    PI: 5.7286
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_29863-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_119.81.7e-0633682156
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1 21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                     RqRKk+++ e ++ v +L  eN++L +e+ el+  +
  TRIUR3_29863-P1 33 RQRKKMRLPEVQQLVRSLAVENESLHEEMRELQRAC 68
                     9*******************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-43371No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MAFPASPEMG HVGSFRRPQL TFQAPPPRPA GQRQRKKMRL PEVQQLVRSL AVENESLHEE  60
MRELQRACSA LSKENDKLET RIEQSNSRNE AALKEQKGKQ QQQLDQQQQQ LDQQQQQSPH  120
DSFALPDLNL PAQDGADGSG VTILSDKIWL LYEVFDNLLY LSL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13238RQRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3642101e-120AK364210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233917.14e-53PREDICTED: uncharacterized protein LOC100835852
TrEMBLM7ZKP61e-116M7ZKP6_TRIUA; Uncharacterized protein
STRINGMLOC_36367.11e-65(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951